PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.010G254200.6.p
Common NameSb10g029190, SORBIDRAFT_10g029190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family SBP
Protein Properties Length: 439aa    MW: 47503.9 Da    PI: 9.9821
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.010G254200.6.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.42.8e-40160236278
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           CqvegC++dls+ak+y+r+hkvC +hskap+v+v+gle+rfCqqCsrfh l efD++krsCrrrL +hn+rrrk+qa
  Sobic.010G254200.6.p 160 CQVEGCKVDLSSAKDYNRKHKVCVAHSKAPKVVVAGLERRFCQQCSRFHGLAEFDQNKRSCRRRLTHHNARRRKPQA 236
                           **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-32152221IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.223157234IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-38158239IPR004333Transcription factor, SBP-box
PfamPF031109.3E-31160233IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 439 aa     Download sequence    Send to blast
MGSFGMNWNQ KNSMVWDWEH LVPSVSNAVT RHGSANSSGG TLTSSSELGH GSSKSSISAS  60
IDSPSGVGNS LEFNFAAVQR HVKNTGTNGR VDDSGNSPSS MIAFSQGEPL ISLKLGKRAY  120
FENVCGGQEA KVSAPSDVTS AVTVVKKTKV SQQNAKNWYC QVEGCKVDLS SAKDYNRKHK  180
VCVAHSKAPK VVVAGLERRF CQQCSRFHGL AEFDQNKRSC RRRLTHHNAR RRKPQADAIS  240
FNSSRLSSMF YDTSHRTNLF FSQPLYGQVR SNAVSPWDNS GGFKFMETKH LSVQPTKTVG  300
LDELHFSTPQ ISTSVVAHTG HHHNFDRFMP FKGTNTKVLN QGVEASATAS NSNNGAPEPG  360
RALSLLSDGS WGSNSAVIQQ PPSHADAGAL PPLATVAVSN TAARHPLDPS LGRFWQDDHP  420
PLDGPAPQIQ ELAHLRTW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-261602331184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9733000.0EU973300.1 Zea mays clone 396397 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002438971.10.0hypothetical protein SORBIDRAFT_10g029190
SwissprotA2YGR51e-159SPL12_ORYSI; Squamosa promoter-binding-like protein 12
TrEMBLC5Z9890.0C5Z989_SORBI; Putative uncharacterized protein Sb10g029190
STRINGSb10g029190.10.0(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.36e-36squamosa promoter binding protein-like 2